Polypeptide GalNac Transferase 3/GALNT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74244

Product Code. 18295883

Description

Polypeptide GalNac Transferase 3/GALNT3 Polyclonal specifically detects Polypeptide GalNac Transferase 3/GALNT3 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Polypeptide GalNac Transferase 3/GALNT3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1.41, GalNAc transferase 3, GalNAc-T3DKFZp686C10199, HFTCMGC61909, HHSPolypeptide GalNAc transferase 3, polypeptide GalNAc-transferase T3, polypeptide N-acetylgalactosaminyltransferase 3, pp-GaNTase 3, Protein-UDP acetylgalactosaminyltransferase 3, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 3 (GalNAc-T3)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2591
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q3T1J4
• Gene Symbols: GALNT3
• Immunogen: Synthetic peptides corresponding to the N terminal of Galnt3. Immunizing peptide sequence PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG