missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POLR2K Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £364.00
Specifications
| Antigen | POLR2K |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
POLR2K Polyclonal antibody specifically detects POLR2K in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| POLR2K | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| PBS (pH 7.3), 50% glycerol | |
| 5440 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ABC10-alpha, DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide, DNA-directed RNA polymerase II subunit K, DNA-directed RNA polymerases I, II, and III subunit RPABC4, hRPB7.0, hsRPB10a, polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa, RNA polymerase II 7.0 kDa subunit, RNA polymerases I, II, and III subunit ABC4, RPABC4, RPB10alphapolymerase (RNA) II (DNA directed) polypeptide K (7.0kD), RPB12, RPB7.0 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-58 of human POLR2K (NP_005025.1). MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title