POLR2K Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93400-0.1ml

Product Code. 18699970

Description

POLR2K Polyclonal antibody specifically detects POLR2K in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: POLR2K
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: ABC10-alpha, DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide, DNA-directed RNA polymerase II subunit K, DNA-directed RNA polymerases I, II, and III subunit RPABC4, hRPB7.0, hsRPB10a, polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa, RNA polymerase II 7.0 kDa subunit, RNA polymerases I, II, and III subunit ABC4, RPABC4, RPB10alphapolymerase (RNA) II (DNA directed) polypeptide K (7.0kD), RPB12, RPB7.0
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-58 of human POLR2K (NP_005025.1). MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
• Quantity: 0.1 mL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 5440
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified