POLR2D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18481481	Novus Biologicals NBP1-92280-25ul	25 μL

Description

POLR2D Polyclonal specifically detects POLR2D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POLR2D
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DNA-directed RNA polymerase II 16 kDa polypeptide, DNA-directed RNA polymerase II subunit D, DNA-directed RNA polymerase II subunit RPB4, HSRBP4, HSRPB4, polymerase (RNA) II (DNA directed) polypeptide D, RBP4, RNA polymerase II 16 kDa subunit, RNA polymerase II subunit B4, RNA polymerase II subunit hsRBP4, RPB16
• Gene Symbols: POLR2D
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5433
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only