POLR2D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-92280-25ul

Product Code. 18481481

Description

POLR2D Polyclonal specifically detects POLR2D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POLR2D
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DNA-directed RNA polymerase II 16 kDa polypeptide, DNA-directed RNA polymerase II subunit D, DNA-directed RNA polymerase II subunit RPB4, HSRBP4, HSRPB4, polymerase (RNA) II (DNA directed) polypeptide D, RBP4, RNA polymerase II 16 kDa subunit, RNA polymerase II subunit B4, RNA polymerase II subunit hsRBP4, RPB16
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: POLR2D
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 5433
• Target Species: Human
• Isotype: IgG

For Research Use Only