missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POGK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | POGK |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
POGK Polyclonal specifically detects POGK in Human samples. It is validated for Western Blot.Specifications
| POGK | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| BASS2, KIAA1513, KIAA15131, KRAB box domain containing 2, KRBOX2, LST003, pogo transposable element with KRAB domain | |
| POGK | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_060012 | |
| 57645 | |
| Synthetic peptide directed towards the middle region of human POGK. Peptide sequence SSESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGEPPKDCDTESMAES. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title