POGK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80337

Product Code. 18268585

Description

POGK Polyclonal specifically detects POGK in Human samples. It is validated for Western Blot.

Specifications

• Antigen: POGK
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BASS2, KIAA1513, KIAA15131, KRAB box domain containing 2, KRBOX2, LST003, pogo transposable element with KRAB domain
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Equine: 92%; Pig: 92%; Rat: 85%; Mouse: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_060012
• Gene Symbols: POGK
• Immunogen: Synthetic peptide directed towards the middle region of human POGK. Peptide sequence SSESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGEPPKDCDTESMAES.
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 57645
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.