missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PNCK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PNCK |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PNCK Polyclonal specifically detects PNCK in Rat samples. It is validated for Western Blot.Specifications
| PNCK | |
| Polyclonal | |
| Rabbit | |
| NP_058971 | |
| 139728 | |
| The immunogen for this antibody is Pnck - C-terminal region. Peptide sequence QKNFARTHWKRAFNATSFLRHIRKLGQSPEGEEASRQGMTRHSHPGLGTS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BSTK3, calcium/calmodulin-dependent protein kinase type 1B, CaM kinase I beta, CaM kinase IB, CaMK1b, CaM-KI beta, CaMKI-beta, EC 2.7.11, EC 2.7.11.17, FLJ50403, FLJ50549, FLJ56451, FLJ59811, MGC45419, pregnancy up-regulated non-ubiquitously expressed CaM kinase, pregnancy upregulated non-ubiquitously expressed CaM kinase, Pregnancy up-regulated non-ubiquitously-expressed CaM kinase | |
| PNCK | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title