missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | PMS2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18222613
|
Novus Biologicals
NBP2-56323 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18663659
|
Novus Biologicals
NBP2-56323-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PMS2 Polyclonal specifically detects PMS2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PMS2 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, DNA Repair, Mismatch Repair | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5395 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| DNA mismatch repair protein PMS2, EC 3.1, H_DJ0042M02.9, HNPCC4postmeiotic segregation increased (S. cerevisiae) 2, mismatch repair endonuclease PMS2, PMS1 protein homolog 2, PMS2 postmeiotic segregation increased 2 (S. cerevisiae), PMSL2PMS2CL | |
| PMS2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title