PMS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56323

Product Code. 18222613

Description

PMS2 Polyclonal specifically detects PMS2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PMS2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DNA mismatch repair protein PMS2, EC 3.1, H_DJ0042M02.9, HNPCC4postmeiotic segregation increased (S. cerevisiae) 2, mismatch repair endonuclease PMS2, PMS1 protein homolog 2, PMS2 postmeiotic segregation increased 2 (S. cerevisiae), PMSL2PMS2CL
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PMS2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRS
• Quantity: 100 μL
• Research Discipline: Cancer, Cell Cycle and Replication, DNA Repair, Mismatch Repair
• Gene ID (Entrez): 5395
• Target Species: Human
• Isotype: IgG

For Research Use Only