PLS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56555

Product Code. 18276892

Description

PLS1 Polyclonal specifically detects PLS1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PLS1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: fimbrin, I plastin, intestine specific plastin, Intestine-specific plastin, I-plastin, plastin 1, plastin 1 (I isoform), Plastin-1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5357
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q14651
• Gene Symbols: PLS1
• Immunogen: Synthetic peptides corresponding to PLS1(plastin 1 (I isoform)) The peptide sequence was selected from the N terminal of PLS1. Peptide sequence ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG