missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PLS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PLS1 Polyclonal specifically detects PLS1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| PLS1 | |
| Polyclonal | |
| Rabbit | |
| Q14651 | |
| 5357 | |
| Synthetic peptides corresponding to PLS1(plastin 1 (I isoform)) The peptide sequence was selected from the N terminal of PLS1. Peptide sequence ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| fimbrin, I plastin, intestine specific plastin, Intestine-specific plastin, I-plastin, plastin 1, plastin 1 (I isoform), Plastin-1 | |
| PLS1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title