PLK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68650

Product Code. 18660758

Description

PLK4 Polyclonal antibody specifically detects PLK4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PLK4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: EC 2.7.11.21, PLK-4, polo-like kinase 4 (Drosophila), polo-like kinase 4SAKSTK18serine/threonine kinase 18, Sak, serine/threonine protein kinase SAK, Serine/threonine-protein kinase 18, serine/threonine-protein kinase PLK4, Serine/threonine-protein kinase Sak, Snk akin kinase
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTP
• Quantity: 100 μg
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers
• Gene ID (Entrez): 10733
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified