missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLEKHA4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | PLEKHA4 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18170108
|
Novus Biologicals
NBP2-47331 |
0.1 mL |
£484.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18699085
|
Novus Biologicals
NBP2-47331-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PLEKHA4 Polyclonal specifically detects PLEKHA4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PLEKHA4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| PEPP-1, PEPP1phosphoinositol 3-phosphate binding protein-1, PH domain-containing family A member 4, phosphoinositol 3-phosphate-binding PH domain protein 1, Phosphoinositol 3-phosphate-binding protein 1, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 4, pleckstrin homology domain-containing family A member 4, pleckstrin homology domain-containing, family A (phosphoinositide bindingspecific) member 4 | |
| PLEKHA4 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 57664 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RTQAHSGSPTYLQLPPRPPGTRASMVLLPGPPLESTFHQSLETDTLLTKLCGQDRLLRRLQEEIDQKQEEKEQLEAALELTRQQLGQA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title