PLEKHA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-47331-25ul

Product Code. 18699085

Description

PLEKHA4 Polyclonal specifically detects PLEKHA4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PLEKHA4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: PEPP-1, PEPP1phosphoinositol 3-phosphate binding protein-1, PH domain-containing family A member 4, phosphoinositol 3-phosphate-binding PH domain protein 1, Phosphoinositol 3-phosphate-binding protein 1, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 4, pleckstrin homology domain-containing family A member 4, pleckstrin homology domain-containing, family A (phosphoinositide bindingspecific) member 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57664
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PLEKHA4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RTQAHSGSPTYLQLPPRPPGTRASMVLLPGPPLESTFHQSLETDTLLTKLCGQDRLLRRLQEEIDQKQEEKEQLEAALELTRQQLGQA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only