missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLAGL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | PLAGL1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18262643
|
Novus Biologicals
NBP2-56498 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18616637
|
Novus Biologicals
NBP2-56498-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PLAGL1 Polyclonal specifically detects PLAGL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PLAGL1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Neuronal Stem Cell Markers, Stem Cell Markers | |
| DKFZp781P1017, LOT-1, LOT1ZACLost on transformation 1, MGC126275, MGC126276, PLAG-like 1, pleiomorphic adenoma gene-like 1, pleiomorphic adenoma gene-like protein 1, Pleiomorphic adenoma-like protein 1, Tumor supressor ZAC, ZAC tumor supressor, ZAC1, zinc finger protein PLAGL1 | |
| PLAGL1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5325 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title