PLAGL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56498

Product Code. 18262643

Description

PLAGL1 Polyclonal specifically detects PLAGL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PLAGL1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DKFZp781P1017, LOT-1, LOT1ZACLost on transformation 1, MGC126275, MGC126276, PLAG-like 1, pleiomorphic adenoma gene-like 1, pleiomorphic adenoma gene-like protein 1, Pleiomorphic adenoma-like protein 1, Tumor supressor ZAC, ZAC tumor supressor, ZAC1, zinc finger protein PLAGL1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PLAGL1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP
• Quantity: 100 μL
• Research Discipline: Apoptosis, Neuronal Stem Cell Markers, Stem Cell Markers
• Gene ID (Entrez): 5325
• Target Species: Human
• Isotype: IgG

For Research Use Only