missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLA1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PLA1A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PLA1A Polyclonal specifically detects PLA1A in Human samples. It is validated for Western Blot.Specifications
| PLA1A | |
| Polyclonal | |
| Rabbit | |
| Q53H76 | |
| 51365 | |
| Synthetic peptides corresponding to PLA1A(phospholipase A1 member A) The peptide sequence was selected from the middle region of PLA1A. Peptide sequence TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.1.1, EC 3.1.1.-, NMD, phosphatidylserine-specific phospholipase A1alpha, phospholipase A1 member A, PS-PLA1, PSPLA1Phosphatidylserine-specific phospholipase A1 | |
| PLA1A | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title