PLA1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58036

Product Code. 18233402

Description

PLA1A Polyclonal specifically detects PLA1A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PLA1A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.1, EC 3.1.1.-, NMD, phosphatidylserine-specific phospholipase A1alpha, phospholipase A1 member A, PS-PLA1, PSPLA1Phosphatidylserine-specific phospholipase A1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51365
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q53H76
• Gene Symbols: PLA1A
• Immunogen: Synthetic peptides corresponding to PLA1A(phospholipase A1 member A) The peptide sequence was selected from the middle region of PLA1A. Peptide sequence TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Chicken: 85%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG