missing translation for 'onlineSavingsMsg'
Learn More
Learn More
-Western-Blot-NBP3-16525-img0002.jpg-650.jpg)
PI 3-Kinase p85 alpha Rabbit anti-Human, Mouse, Rat, Clone: 7Z9H0, Novus Biologicals™
Rabbit Monoclonal Antibody
£150.00 - £395.00
Specifications
| Antigen | PI 3-Kinase p85 alpha |
|---|---|
| Clone | 7Z9H0 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18341457
|
Novus Biologicals
NBP3-16525-20UL |
20 μg |
£150.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18336805
|
Novus Biologicals
NBP3-16525-100UL |
100 μg |
£395.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PI 3-Kinase p85 alpha Monoclonal antibody specifically detects PI 3-Kinase p85 alpha in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| PI 3-Kinase p85 alpha | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| AGM7, GRB1, IMD36, p85, p85-ALPHA, Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), phosphatidylinositol 3-kinase-associated p-85 alpha, phosphoinositide-3-kinase regulatory subunit alpha, phosphoinositide-3-kinase, regulatory subunit 1 (alpha), PI3K regulatory subunit alpha, PI3-kinase regulatory subunit alpha, PI3-kinase subunit p85-alpha, PIK3R1, PtdIns-3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit p85-alpha | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI 3-Kinase p85 alpha (P27986). MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 7Z9H0 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Diabetes Research, Immune Dysfunction, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 5295 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title