missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PI 3-Kinase p85 alpha Rabbit anti-Human, Mouse, Rat, Clone: 7Z9H0, Novus Biologicals™

PI 3-Kinase p85 alpha Rabbit anti-Human, Mouse, Rat, Clone: 7Z9H0, Novus Biologicals™

Product Code. 18336805 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18336805 100 μg 100µL
18341457 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18336805 Supplier Novus Biologicals Supplier No. NBP316525100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

PI 3-Kinase p85 alpha Monoclonal antibody specifically detects PI 3-Kinase p85 alpha in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen PI 3-Kinase p85 alpha
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 7Z9H0
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias AGM7, GRB1, IMD36, p85, p85-ALPHA, Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), phosphatidylinositol 3-kinase-associated p-85 alpha, phosphoinositide-3-kinase regulatory subunit alpha, phosphoinositide-3-kinase, regulatory subunit 1 (alpha), PI3K regulatory subunit alpha, PI3-kinase regulatory subunit alpha, PI3-kinase subunit p85-alpha, PIK3R1, PtdIns-3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit p85-alpha
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI 3-Kinase p85 alpha (P27986). MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Diabetes Research, Immune Dysfunction, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5295
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.