missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHACTR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PHACTR3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PHACTR3 Polyclonal specifically detects PHACTR3 in Human samples. It is validated for Western Blot.Specifications
| PHACTR3 | |
| Polyclonal | |
| Rabbit | |
| B1AN69 | |
| 116154 | |
| Synthetic peptides corresponding to PHACTR3(phosphatase and actin regulator 3) The peptide sequence was selected from the C terminal of PHACTR3. Peptide sequence IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C20orf101, chromosome 20 open reading frame 101, H17739, MGC117178, phosphatase and actin regulator 3, scaffold-associated PP1 inhibiting protein, Scaffold-associated PP1-inhibiting protein, SCAPIN1, Scapinin | |
| PHACTR3 | |
| IgG | |
| 51 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title