PHACTR3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54364

Product Code. 18295271

Description

PHACTR3 Polyclonal specifically detects PHACTR3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PHACTR3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C20orf101, chromosome 20 open reading frame 101, H17739, MGC117178, phosphatase and actin regulator 3, scaffold-associated PP1 inhibiting protein, Scaffold-associated PP1-inhibiting protein, SCAPIN1, Scapinin
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B1AN69
• Gene Symbols: PHACTR3
• Immunogen: Synthetic peptides corresponding to PHACTR3(phosphatase and actin regulator 3) The peptide sequence was selected from the C terminal of PHACTR3. Peptide sequence IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 116154
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG