missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PFTK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PFTK1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PFTK1 Polyclonal specifically detects PFTK1 in Mouse samples. It is validated for Western Blot.Specifications
| PFTK1 | |
| Polyclonal | |
| Rabbit | |
| NP_035204 | |
| 5218 | |
| The immunogen for this antibody is Cdk14 - C-terminal region. Peptide sequence SDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Cell division protein kinase 14, cyclin-dependent kinase 14, EC 2.7.11, KIAA0834EC 2.7.11.22, PFTAIRE1hPFTAIRE1, PFTK1PFTAIRE protein kinase 1, Serine/threonine-protein kinase PFTAIRE-1 | |
| CDK14 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title