missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PFTK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-98270
This item is not returnable.
View return policy
Description
PFTK1 Polyclonal specifically detects PFTK1 in Mouse samples. It is validated for Western Blot.
Specifications
| PFTK1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Cell division protein kinase 14, cyclin-dependent kinase 14, EC 2.7.11, KIAA0834EC 2.7.11.22, PFTAIRE1hPFTAIRE1, PFTK1PFTAIRE protein kinase 1, Serine/threonine-protein kinase PFTAIRE-1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 5218 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_035204 | |
| CDK14 | |
| The immunogen for this antibody is Cdk14 - C-terminal region. Peptide sequence SDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%; Xenopus: 85%; Chicken: 85%. | |
| Human, Mouse, Rat, Pig, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction