missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEX5L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PEX5L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PEX5L Polyclonal specifically detects PEX5L in Mouse samples. It is validated for Western Blot.Specifications
| PEX5L | |
| Polyclonal | |
| Rabbit | |
| NP_067458 | |
| 51555 | |
| Synthetic peptide directed towards the C terminal of human Pex2. Peptide sequence QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PEX5-related protein, peroxisomal biogenesis factor 5-like, PEX5R, PEX5RP, PXR2, PXR2B | |
| PEX5L | |
| IgG | |
| 68 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title