PEG10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Code produit	Marque	Quantity
18400092	Novus Biologicals NBP2-13749-25ul	25ul
18785393	Novus Biologicals NBP2-13749	0.1 mL

Description

PEG10 Polyclonal specifically detects PEG10 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spécification

• Antigen: PEG10
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 23089
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: embryonal carcinoma differentiation regulated, Embryonal carcinoma differentiation-regulated protein, HB-1, KIAA1051EDR, Mammalian retrotransposon-derived protein 2, Mar2, Mart2, MEF3 like 1, MEF3L, MEF3L1, Myelin expression factor 3-like protein 1, paternally expressed 10, Paternally expressed gene 10 protein, retrotransposon gag domain containing 3, Retrotransposon gag domain-containing protein 3, Retrotransposon-derived gag-like polyprotein, retrotransposon-derived protein PEG10, RGAG3MEF3-like protein 1, Ty3/Gypsy-like protein
• Gene Symbols: PEG10
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only