missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEG10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP2-13749-25ul
This item is not returnable.
View return policy
Description
PEG10 Polyclonal specifically detects PEG10 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| PEG10 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| embryonal carcinoma differentiation regulated, Embryonal carcinoma differentiation-regulated protein, HB-1, KIAA1051EDR, Mammalian retrotransposon-derived protein 2, Mar2, Mart2, MEF3 like 1, MEF3L, MEF3L1, Myelin expression factor 3-like protein 1, paternally expressed 10, Paternally expressed gene 10 protein, retrotransposon gag domain containing 3, Retrotransposon gag domain-containing protein 3, Retrotransposon-derived gag-like polyprotein, retrotransposon-derived protein PEG10, RGAG3MEF3-like protein 1, Ty3/Gypsy-like protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 23089 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PEG10 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction