missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDHA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | PDHA2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PDHA2 Polyclonal specifically detects PDHA2 in Human samples. It is validated for Western Blot.Specifications
| PDHA2 | |
| Polyclonal | |
| Rabbit | |
| NP_005381 | |
| 5161 | |
| Synthetic peptide directed towards the N terminal of human PDHA2The immunogen for this antibody is PDHA2. Peptide sequence RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 1.2.4.1, MGC149517, MGC149518, mitochondrial, PDHAL, PDHE1-A type II, pyruvate dehydrogenase (lipoamide) alpha 2, pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, pyruvate dehydrogenase, E1-alpha polypeptide, testis specific | |
| PDHA2 | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title