missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PD-L2/B7-DC/PDCD1LG2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
£258.00 - £435.00
Specifications
| Antigen | PD-L2/B7-DC/PDCD1LG2 |
|---|---|
| Concentration | 0.1mg/mL |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18481211
|
Novus Biologicals
NBP1-88964-25ul |
25 μL |
£258.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18254466
|
Novus Biologicals
NBP1-88964 |
0.1 mL |
£435.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PD-L2/B7-DC/PDCD1LG2 Polyclonal specifically detects PD-L2/B7-DC/PDCD1LG2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PD-L2/B7-DC/PDCD1LG2 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 80380 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| 0.1mg/mL | |
| Polyclonal | |
| Rabbit | |
| Human | |
| B7-DC, bA574F11.2, Btdc, Butyrophilin B7-DC, CD273 antigen, CD273PD-1 ligand 2, MGC142240, PD-1-ligand 2, PDCD1L2MGC142238, PDL2B7DC, PD-L2PDCD1 ligand 2, programmed cell death 1 ligand 2, Programmed death ligand 2 | |
| PDCD1LG2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title