missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCTAIRE3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94133-0.1ml
This item is not returnable.
View return policy
Description
PCTAIRE3 Polyclonal antibody specifically detects PCTAIRE3 in Human, Mouse samples. It is validated for Western Blot
Specifications
| PCTAIRE3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Cell division protein kinase 18, cyclin-dependent kinase 18, EC 2.7.11, EC 2.7.11.22, PCTAIRE, PCTAIRE3, PCTAIRE-motif protein kinase 3, PCTK3PCTAIRE protein kinase 3, Serine/threonine-protein kinase PCTAIRE-3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human CDK18 (NP_002587.2). EFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF | |
| 0.1 mL | |
| Protein Kinase | |
| 5129 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction