missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCPE-1/PCOLCE Antibody (CL6567), Novus Biologicals™
Mouse Monoclonal Antibody
£328.00 - £451.00
Specifications
| Antigen | PCPE-1/PCOLCE |
|---|---|
| Clone | CL6567 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18620841
|
Novus Biologicals
NBP2-76506-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18209628
|
Novus Biologicals
NBP2-76506 |
100 μL |
£451.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PCPE-1/PCOLCE Monoclonal specifically detects PCPE-1/PCOLCE in Human samples. It is validated for Western Blot.Specifications
| PCPE-1/PCOLCE | |
| Western Blot | |
| Unconjugated | |
| Mouse | |
| Human | |
| PCPE, PCPE-1, PCPE1Type I procollagen COOH-terminal proteinase enhancer, procollagen C-endopeptidase enhancer, procollagen C-endopeptidase enhancer 1, Procollagen COOH-terminal proteinase enhancer 1, Procollagen C-proteinase enhancer 1, procollagen, type 1, COOH-terminal proteinase enhancer, Type 1 procollagen C-proteinase enhancer protein | |
| PCOLCE | |
| IgG1 | |
| Protein A purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| CL6567 | |
| Monoclonal | |
| Purified | |
| Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| 5118.0 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title