PCPE-1/PCOLCE Antibody (CL6567), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP2-76506

Product Code. 18209628

Description

PCPE-1/PCOLCE Monoclonal specifically detects PCPE-1/PCOLCE in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PCPE-1/PCOLCE
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: PCOLCE
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Western Blot
• Clone: CL6567
• Dilution: Western Blot 1 ug/ml
• Gene Alias: PCPE, PCPE-1, PCPE1Type I procollagen COOH-terminal proteinase enhancer, procollagen C-endopeptidase enhancer, procollagen C-endopeptidase enhancer 1, Procollagen COOH-terminal proteinase enhancer 1, Procollagen C-proteinase enhancer 1, procollagen, type 1, COOH-terminal proteinase enhancer, Type 1 procollagen C-proteinase enhancer protein
• Host Species: Mouse
• Purification Method: Protein A purified
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5118.0
• Target Species: Human
• Form: Purified