missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAPOLG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | PAPOLG |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18288971
|
Novus Biologicals
NBP2-55534 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18668146
|
Novus Biologicals
NBP2-55534-25ul |
0.025 mg |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PAPOLG Polyclonal specifically detects PAPOLG in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| PAPOLG | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC 2.7.7.19, FLJ11805, FLJ12972, FLJ13482, FLJ14187, MGC133307, MGC133308, neo-PAP, Neo-poly(A) polymerase, nuclear poly(A) polymerase gamma, PAP2, PAPG, PAP-gamma, poly(A) polymerase gamma, Polynucleotide adenylyltransferase gamma, SRP RNA 3' adenylating enzyme/pap2, SRP RNA 3'-adenylating enzyme | |
| PAPOLG | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 64895 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KQLHHYLPAEILQKKKKQSLSDVNRSSGGLQSKRLSLDSSCLDSSRDTDNGTPFNSPASKSDSPSVGETERN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title