missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | PAIP1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18653729
|
Novus Biologicals
NBP2-68963-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18648948
|
Novus Biologicals
NBP2-68963 |
100 μg |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
PAIP1 Polyclonal antibody specifically detects PAIP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifikationer
| PAIP1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| MGC12360, PABC1-interacting protein 1, PABP-interacting protein 1, PAIP-1, poly(A) binding protein interacting protein 1, Poly(A)-binding protein-interacting protein 1, polyadenylate binding protein-interacting protein 1, polyadenylate-binding protein-interacting protein 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 10605 | |
| IgG | |
| Protein A purified |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel