missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAGE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | PAGE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
PAGE1 Polyclonal specifically detects PAGE1 in Human samples. It is validated for Western Blot.Specifications
| PAGE1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| O75459 | |
| 8712 | |
| Synthetic peptides corresponding to PAGE1(P antigen family, member 1 (prostate associated)) The peptide sequence was selected from the middle region of PAGE1. Peptide sequence TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CT16.3, G antigen, family B, 1 (prostate associated), GAGE9, GAGE-9AL5, GAGEB1G antigen family B member 1, P antigen family, member 1 (prostate associated), PAGE-1G antigen 9, prostate associated gene 1, Prostate-associated gene 1 protein | |
| PAGE1 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title