PAFAH1B2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56301

Product Code. 18266414

Description

PAFAH1B2 Polyclonal specifically detects PAFAH1B2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PAFAH1B2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.1.47, intracellular platelet-activating factor acetylhydrolase alpha 2 subunit, PAF acetylhydrolase 30 kDa subunit, PAF-AH 30 kDa subunit, PAFAH subunit beta, PAF-AH subunit beta, PAF-AH1b alpha 2 subunit, PAFAHB, platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa), platelet-activating factor acetylhydrolase IB subunit beta, platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa, platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5049
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O35264
• Gene Symbols: PAFAH1B2
• Immunogen: Synthetic peptides corresponding to PAFAH1B2(platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa) The peptide sequence was selected from the N terminal of PAFAH1B2. Peptide sequence MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta.
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG