PABPC1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55978-25ul

Código de producto. 18645398

Descripción

PABPC1L Polyclonal specifically detects PABPC1L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Especificaciones

• Antigen: PABPC1L
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C20orf119, Chromosome 20 Open Reading Frame 119, DJ1069P2.3, Embryonic Poly(A) Binding Protein, EPAB, PABPC1L1, Poly(A) Binding Protein Cytoplasmic 1 Like, Poly(A) Binding Protein, Cytoplasmic 1-Like, Polyadenylate-Binding Protein 1-Like
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80336
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PABPC1L
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles.

For Research Use Only