missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P4HA3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£159.00 - £366.00
Specifications
| Antigen | P4HA3 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18698260
|
Novus Biologicals
NBP2-94641-0.02ml |
0.02 mL |
£159.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18601711
|
Novus Biologicals
NBP2-94641-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
P4HA3 Polyclonal antibody specifically detects P4HA3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| P4HA3 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 283208 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| 2-oxoglutarate-4-dioxygenase subunit alpha-3, 4-PH alpha-3, alpha polypeptide III, collagen prolyl 4-hydroxylase alpha(III), C-P4H alpha III, C-P4Halpha(III), EC 1.14.11.2, Procollagen-proline, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), prolyl 4-hydroxylase subunit alpha-3, prolyl 4-hydroxylase, alpha polypeptide III | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1). DPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEAS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title