missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P4HA3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94641-0.1ml
This item is not returnable.
View return policy
Description
P4HA3 Polyclonal antibody specifically detects P4HA3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| P4HA3 | |
| Polyclonal | |
| Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| 2-oxoglutarate-4-dioxygenase subunit alpha-3, 4-PH alpha-3, alpha polypeptide III, collagen prolyl 4-hydroxylase alpha(III), C-P4H alpha III, C-P4Halpha(III), EC 1.14.11.2, Procollagen-proline, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), prolyl 4-hydroxylase subunit alpha-3, prolyl 4-hydroxylase, alpha polypeptide III | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1). DPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEAS | |
| 0.1 mL | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 283208 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction