missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p21/CIP1/CDKN1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£232.00 - £419.00
Specifications
| Antigen | p21/CIP1/CDKN1A |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18202512
|
Novus Biologicals
NBP2-58874 |
100 μL |
£419.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18651898
|
Novus Biologicals
NBP2-58874-25ul |
25 μL |
£232.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
p21/CIP1/CDKN1A Polyclonal specifically detects p21/CIP1/CDKN1A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| p21/CIP1/CDKN1A | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, DNA Repair | |
| CAP20cyclin-dependent kinase inhibitor 1, CDK-interacting protein 1, CDKN1melanoma differentiation associated protein 6, CIP1WAF1CDK-interaction protein 1, cyclin-dependent kinase inhibitor 1A (p21, Cip1), MDA6, MDA-6, Melanoma differentiation-associated protein 6, p21, p21CIP1, p21Cip1/Waf1, PIC1, SDI1DNA synthesis inhibitor, wild-type p53-activated fragment 1 | |
| CDKN1A | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1026 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title