p21/CIP1/CDKN1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58874

Product Code. 18202512

Description

p21/CIP1/CDKN1A Polyclonal specifically detects p21/CIP1/CDKN1A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: p21/CIP1/CDKN1A
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CAP20cyclin-dependent kinase inhibitor 1, CDK-interacting protein 1, CDKN1melanoma differentiation associated protein 6, CIP1WAF1CDK-interaction protein 1, cyclin-dependent kinase inhibitor 1A (p21, Cip1), MDA6, MDA-6, Melanoma differentiation-associated protein 6, p21, p21CIP1, p21Cip1/Waf1, PIC1, SDI1DNA synthesis inhibitor, wild-type p53-activated fragment 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CDKN1A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKR
• Quantity: 100 μL
• Research Discipline: Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, DNA Repair
• Gene ID (Entrez): 1026
• Target Species: Human
• Isotype: IgG

For Research Use Only