missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OSBPL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | OSBPL5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18666065
|
Novus Biologicals
NBP2-38858-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18115919
|
Novus Biologicals
NBP2-38858 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OSBPL5 Polyclonal specifically detects OSBPL5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| OSBPL5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9H0X9 | |
| 114879 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEEL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 1.2.1, EC 2.7.7.6, FLJ42929, KIAA1534oxysterol-binding protein-related protein 5, OBPH1, ORP-5, ORP5oxysterol-binding protein homologue 1, OSBP-related protein 5, oxysterol binding protein-like 5, oxysterol-binding protein homolog 1, Oxysterol-binding protein homolog 1; | |
| OSBPL5 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title