missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR2W1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | OR2W1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
OR2W1 Polyclonal specifically detects OR2W1 in Human samples. It is validated for Western Blot.Specifications
| OR2W1 | |
| Polyclonal | |
| Rabbit | |
| Q9Y3N9 | |
| 26692 | |
| Synthetic peptides corresponding to OR2W1 (olfactory receptor, family 2, subfamily W, member 1) The peptide sequence was selected from the C terminal of OR2W1. Peptide sequence VVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| hs6M1-15, MGC119162, MGC119163, MGC119165, olfactory receptor 2W1, Olfactory receptor OR6-13, olfactory receptor, family 2, subfamily W, member 1 | |
| OR2W1 | |
| IgG | |
| 36 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title