OR2W1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69041

Product Code. 18233182

Description

OR2W1 Polyclonal specifically detects OR2W1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR2W1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hs6M1-15, MGC119162, MGC119163, MGC119165, olfactory receptor 2W1, Olfactory receptor OR6-13, olfactory receptor, family 2, subfamily W, member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y3N9
• Gene Symbols: OR2W1
• Immunogen: Synthetic peptides corresponding to OR2W1 (olfactory receptor, family 2, subfamily W, member 1) The peptide sequence was selected from the C terminal of OR2W1. Peptide sequence VVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26692
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG