missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR2F1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | OR2F1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR2F1 Polyclonal specifically detects OR2F1 in Rat samples. It is validated for Western Blot.Specifications
| OR2F1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| OLF3OR2F3P, olfactory receptor 2F1, Olfactory receptor 2F3, Olfactory receptor 2F4, Olfactory receptor 2F5, olfactory receptor OR7-7, olfactory receptor, family 2, subfamily F, member 1, olfactory receptor, family 2, subfamily F, member 3, olfactory receptor, family 2, subfamily F, member 4, olfactory receptor, family 2, subfamily F, member 5, Olfactory receptor-like protein OLF3, OR14-60, OR2F3, OR2F4, OR2F5, OR7-139, OR7-140 | |
| The immunogen is a synthetic peptide directed towards the middle region of Rat OR2F1 (NP_001000976). Peptide sequence IISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQ | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 26211 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title