missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OR2F1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

OR2F1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Product Code. 18334915 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18334915 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18334915 Supplier Novus Biologicals Supplier No. NBP309391100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

OR2F1 Polyclonal specifically detects OR2F1 in Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen OR2F1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias OLF3OR2F3P, olfactory receptor 2F1, Olfactory receptor 2F3, Olfactory receptor 2F4, Olfactory receptor 2F5, olfactory receptor OR7-7, olfactory receptor, family 2, subfamily F, member 1, olfactory receptor, family 2, subfamily F, member 3, olfactory receptor, family 2, subfamily F, member 4, olfactory receptor, family 2, subfamily F, member 5, Olfactory receptor-like protein OLF3, OR14-60, OR2F3, OR2F4, OR2F5, OR7-139, OR7-140
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Rat OR2F1 (NP_001000976). Peptide sequence IISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQ
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26211
Target Species Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.