OR13C5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80011

Product Code. 18257225

Description

OR13C5 Polyclonal specifically detects OR13C5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR13C5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: olfactory receptor 13C5, olfactory receptor, family 13, subfamily C, member 5
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001004482
• Gene Symbols: OR13C5
• Immunogen: Synthetic peptide directed towards the N terminal of human OR13C5. Peptide sequence ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 138799
• Target Species: Human, Rat, Pig, Canine, Equine
• Isotype: IgG