missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Optimedin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Optimedin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Optimedin Polyclonal specifically detects Optimedin in Mouse samples. It is validated for Western Blot.Specifications
| Optimedin | |
| Polyclonal | |
| Rabbit | |
| 229759 | |
| 118427 | |
| Synthetic peptides corresponding to the C terminal of Olfm3. Immunizing peptide sequence PKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NOE3OPTIMEDIN, noelin 3, noelin-3, NOELIN3, NOELIN3_V1, NOELIN3_V2, NOELIN3_V3, NOELIN3_V4, NOELIN3_V5, NOELIN3_V6, olfactomedin 3, olfactomedin related ER localized protein 3, Olfactomedin-3, Optimedin | |
| OLFM3 | |
| IgG | |
| 53 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title