missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Optimedin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-74249
This item is not returnable.
View return policy
Description
Optimedin Polyclonal specifically detects Optimedin in Mouse samples. It is validated for Western Blot.
Specifications
| Optimedin | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| NOE3OPTIMEDIN, noelin 3, noelin-3, NOELIN3, NOELIN3_V1, NOELIN3_V2, NOELIN3_V3, NOELIN3_V4, NOELIN3_V5, NOELIN3_V6, olfactomedin 3, olfactomedin related ER localized protein 3, Olfactomedin-3, Optimedin | |
| Rabbit | |
| 53 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Chicken: 100%; Xenopus: 92%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| 229759 | |
| OLFM3 | |
| Synthetic peptides corresponding to the C terminal of Olfm3. Immunizing peptide sequence PKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYF. | |
| Affinity purified | |
| RUO | |
| 118427 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction